Pramlintide

Pricing Availability   Qty
Description: Synthetic version of amylin (Cat. No. 3418)
Purity: ≥95% (HPLC)
Datasheet
Citations (1)
Reviews
Literature (1)

Biological Activity for Pramlintide

Pramlintide is a synthetic version of amylin (Cat. No. 3418). Exhibits high affinity for amylin, CGRP and calcitonin receptors (Ki values are 0.023, 3.8 and 5.1 nM respectively). Reduces postprandial hyperglycemia; also inhibits gastric emptying.

Technical Data for Pramlintide

M. Wt 3949.42
Formula C171H267N51O53S2
Sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY

(Modifications: Tyr-37 = C-terminal amide, Disulfide bridge: 2-7)

Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 151126-32-8
PubChem ID 70691388
InChI Key TZIRZGBAFTZREM-MKAGXXMWSA-N
Smiles [H]N[C@@H](CCCCN)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC1=O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Pramlintide

Solubility Soluble to 1 mg/ml in water

Product Datasheets for Pramlintide

Certificate of Analysis / Product Datasheet
Select another batch:

References for Pramlintide

References are publications that support the biological activity of the product.

Young et al (1996) Preclinical pharmacology of pramli. in the rat: comparisons with human and rat amylin. Drug Dev.Res. 37 231

Hoogwerf et al (2008) Pramlintide, the synthetic analogue of amylin: phsyiology, pathophysiology, and effects on glycemic control, body weight, and selected biomarkers of vascular risk. Vasc.Health Risk Manag. 4 355 PMID: 18561511


If you know of a relevant reference for Pramlintide, please let us know.

View Related Products by Product Action

View all Calcitonin and Related Receptor Agonists

Keywords: Pramlintide, Pramlintide supplier, Pramlintide, antidiabetic, amylin, synthetic, calcitonin, CGRP, receptors, Calcitonin, and, Related, Receptors, 5031, Tocris Bioscience

1 Citation for Pramlintide

Citations are publications that use Tocris products. Selected citations for Pramlintide include:

Stephen D et al (2021) Area Postrema Cell Types that Mediate Nausea-Associated Behaviors. Neuron 109 461-472.e5 PMID: 33278342


Do you know of a great paper that uses Pramlintide from Tocris? Please let us know.

Reviews for Pramlintide

There are currently no reviews for this product. Be the first to review Pramlintide and earn rewards!

Have you used Pramlintide?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Peptides Involved in Appetite Modulation Scientific Review

Peptides Involved in Appetite Modulation Scientific Review

Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.